PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30073.m002204
Common NameLOC8283041, RCOM_1323550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 843aa    MW: 90820.9 Da    PI: 6.5668
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30073.m002204genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS415.74.1e-1274558122374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +lLl+cAeavs++++e+a+++L ++s+l++p+g++ qR+aayf eA++arl +s+ ++y++lp+ + +  ++++ ++a+++f+ +sP++kfsh+t
  30073.m002204 455 LTLLLQCAEAVSADNFEEANKMLLEISQLSTPYGTSAQRVAAYFSEAMSARLINSCLGIYATLPSMPLT--HTQKMASAFQVFNGISPFVKFSHFT 548
                    579************************************************************999998..5889999****************** PP

           GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                    aNqaI ea+e+e+rvHiiD+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s e+le+tg+rL++fA++lg+pfef + va+++ +l++++
  30073.m002204 549 ANQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGPPYVRLTGLGT----SIEALEATGKRLSDFAQKLGLPFEFFP-VADKVGNLDPDR 639
                    ****************************************************....9**************************.7*********** PP

           GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                    L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl a++++eseer++vE++l
  30073.m002204 640 LNVSKREAVAVHWLQ--HSLYDVTGSDSN----TLWLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALFDSLGASYGEESEERHVVEQQL 728
                    **************9..999999999999....**********************.899************************************* PP

           GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    l+rei+nv+a  g +r  + + +++Wre+l+++GFk ++l  +aa+qa lll +++sdgy++ e++g+l lgWkd  L+++SaWr
  30073.m002204 729 LSREIRNVLAVGGPSRSGEVK-FHNWREKLRQSGFKGISLAGNAATQATLLLGMFPSDGYTLVEDNGTLKLGWKDLCLLTASAWR 812
                    ***************888776.**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.565428792IPR005202Transcription factor GRAS
PfamPF035141.4E-124455812IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 843 aa     Download sequence    Send to blast
MAAAPGSLFL ENGSDTHDLN VSSTTTNSSS SPLTSGSSNT TISSSKESKM VRKRMACEMM  60
ELQATTSNQN QRCYRRMMSN SSNNNTVQGV AADDNINGAC SSLLTNIINP NVQNPNPNPN  120
PNPYPLLNYS TMSMTTTMLP SSTNMTSMTS GGSMSASLCG FLSSTATNNF SSCNDTLSSL  180
HTPAPAPTPT PTPTPTPAPA PAPAPAVCGF SGLPLFPSEG ERTRNAAVPV VISSPSPPSM  240
EDASATAWID GIIKDLIHSS TNVSIPQLIQ NVREIIFPCN PSLASLLEYR LRSLAEAIPN  300
YPVDRRRKEA YSNIQGQGSS GLSLNVTSFP SLPDSTAAVA VVAAAPPVVN QYPSWGSTPP  360
LINQHIHHHQ IHIHDQQQQQ QGSPSSTSVT PPVLGLNQGH PHPQPQQEQE KSSSAETEHV  420
AASTPASVPT PPTSAREKKE EQRQQKRDEE GLHLLTLLLQ CAEAVSADNF EEANKMLLEI  480
SQLSTPYGTS AQRVAAYFSE AMSARLINSC LGIYATLPSM PLTHTQKMAS AFQVFNGISP  540
FVKFSHFTAN QAIQEAFERE DRVHIIDLDI MQGLQWPGLF HILASRPGGP PYVRLTGLGT  600
SIEALEATGK RLSDFAQKLG LPFEFFPVAD KVGNLDPDRL NVSKREAVAV HWLQHSLYDV  660
TGSDSNTLWL LQRLAPKVVT VVEQDLSHAG SFLGRFVEAI HYYSALFDSL GASYGEESEE  720
RHVVEQQLLS REIRNVLAVG GPSRSGEVKF HNWREKLRQS GFKGISLAGN AATQATLLLG  780
MFPSDGYTLV EDNGTLKLGW KDLCLLTASA WRPFHATATA AAATATATAA AIHRYHHHQF  840
ATA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-484548124375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519983.10.0PREDICTED: protein SCARECROW isoform X1
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
TrEMBLB9S1W40.0B9S1W4_RICCO; Transcription factor, putative
STRINGPOPTR_0006s11500.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein